PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10024686m
Common NameEUTSA_v10024686mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family ARR-B
Protein Properties Length: 624aa    MW: 68612.2 Da    PI: 7.0533
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10024686mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like911.1e-28210263155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      kpr++W+ eLH++Fv av+qL G +kA+Pk+ile+m+v+gLt+e+v+SHLQkYR+
  Thhalv10024686m 210 KPRVVWSVELHQQFVAAVNQL-GVDKAVPKKILEMMNVPGLTRENVASHLQKYRI 263
                      79*******************.********************************7 PP

2Response_reg75.22.4e-25301381109
                      EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHT CS
     Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealka 92 
                      vl+vdD+++ +++l+++l +  y +v+ +  +e al +l++++  +D+++ D+ mp+mdG++ll++   e  +lp+i+++a ++++ +l+ +  
  Thhalv10024686m  30 VLVVDDDKTCLKILERMLMNCLY-RVTKCNRAEIALSMLRKNKngFDIVISDVHMPDMDGFKLLEHVGLEM-DLPVIMMSADDSKSVVLQGVTH 121
                      89*********************.***************999889**********************6644.8********************* PP

                      TESEEEESS--HHHHHH CS
     Response_reg  93 GakdflsKpfdpeelvk 109
                      Ga d+l Kp+ +e+l +
  Thhalv10024686m 122 GAVDYLIKPVRIEALKN 138
                      *************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363922.6E-17811615IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23001.0E-4027179No hitNo description
SuperFamilySSF521726.69E-3427152IPR011006CheY-like superfamily
SMARTSM004481.0E-2828140IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011040.24529144IPR001789Signal transduction response regulator, receiver domain
PfamPF000725.9E-2230138IPR001789Signal transduction response regulator, receiver domain
CDDcd001569.06E-2631143No hitNo description
PROSITE profilePS5129411.323207266IPR017930Myb domain
SuperFamilySSF466896.63E-20208267IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.6E-30209268IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-24210263IPR006447Myb domain, plants
PfamPF002499.5E-9212262IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009873Biological Processethylene-activated signaling pathway
GO:0010082Biological Processregulation of root meristem growth
GO:0010119Biological Processregulation of stomatal movement
GO:0010150Biological Processleaf senescence
GO:0071368Biological Processcellular response to cytokinin stimulus
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 624 aa     Download sequence    Send to blast
MINPGHGRGP DSSVVGGSSN SDPFPAGLRV LVVDDDKTCL KILERMLMNC LYRVTKCNRA  60
EIALSMLRKN KNGFDIVISD VHMPDMDGFK LLEHVGLEMD LPVIMMSADD SKSVVLQGVT  120
HGAVDYLIKP VRIEALKNIW QHVVRKKRNV SEHSGSVEDV GGGDRQQQRN DADNNSSSAN  180
EGNWRSSRKR KEEEVEEQGE DKEDTSSLKK PRVVWSVELH QQFVAAVNQL GVDKAVPKKI  240
LEMMNVPGLT RENVASHLQK YRIYLRRLGG VSQHQGGNMN HSFMNVQDPL STLNGFDLQA  300
LAVAGQSLAH LQAAGHGRSS LTKPGMSVPP LADQRSIFSF ENPKTRQTMN LVGNNKQMNL  360
LHGVPTGMEP KQFTGSHMRV QQNVQSSGML MPVADQLPRG GPAMLPSLRQ QPMLSSSVSR  420
RSDLTDAVAS SRVLPATTHS VFNSFPLASA PGISIPVSVS CQEEVNSSDA KGGSLAATGF  480
GNPSYDIFSE FPQQNNNNNK RNDWDLRNIG LVYNTHQDTS AFSTSEAYSS SSTQRKRQEA  540
ELTEQQHQPL NRSLNHMNQV YMNGGGSVRV KSERVAETVT CPPAITMFHE QYNQEDLLSA  600
LLKQEGIPSE FDFDGYSIDN IPV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-21206268163ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00054PBMTransfer from AT4G16110Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ4735210.0DQ473521.1 Arabidopsis thaliana ARR2 (ARR2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006414393.10.0hypothetical protein EUTSA_v10024686mg
SwissprotQ9ZWJ90.0ARR2_ARATH; Two-component response regulator ARR2
TrEMBLV4P8950.0V4P895_EUTSA; Uncharacterized protein
STRINGscaffold_702902.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24032773
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.10.0response regulator 2